PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g002710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 239aa    MW: 27987.1 Da    PI: 4.9109
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g002710.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.3e-183384556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +f++eq++ Le+ Fe++  +  +++ + A++lgL+ rqV +WFqN+Ra++k
  Csa07g002710.1 33 KRFSEEQIKSLERIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 84
                    68*************************************************9 PP

2HD-ZIP_I/II119.71.5e-3831122293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +++r+s+eq+k+LE+ Fe+e++Lep++Kv++areLglqprqva+WFqn+RAR+ktkqlEk+y+ L+++y++l+++ + ++ke+++L +el++
  Csa07g002710.1  31 NQKRFSEEQIKSLERIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNILRANYNNLASQFDIMKKEKQALVSELQR 122
                     589*************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.34E-171488IPR009057Homeodomain-like
SMARTSM003891.4E-132390IPR001356Homeobox domain
PROSITE profilePS5007117.0062686IPR001356Homeobox domain
CDDcd000861.12E-133287No hitNo description
PfamPF000462.5E-153384IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-173393IPR009057Homeodomain-like
PRINTSPR000312.8E-55766IPR000047Helix-turn-helix motif
PROSITE patternPS0002706184IPR017970Homeobox, conserved site
PRINTSPR000312.8E-56682IPR000047Helix-turn-helix motif
PfamPF021837.7E-1686126IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MEEGDFFNCC FSETNSGMTM MNKKKMKKSY NQKRFSEEQI KSLERIFESE TRLEPRKKVQ  60
VARELGLQPR QVAIWFQNKR ARWKTKQLEK EYNILRANYN NLASQFDIMK KEKQALVSEL  120
QRLNEEIHNK PKEERDHECC GEQGVALSSS TESHNGKCEP EVRLNQGIVL CNDDGDNNNI  180
KTEYFGFEEE TDHHELMNIV EQPDDSCLTS SDNWGGFNSD SLLDQSSSNY PNWWEFWT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00013PBMTransfer from AT3G61890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0598280.0AY059828.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (F21F14.6) mRNA, complete cds.
GenBankAY0871870.0AY087187.1 Arabidopsis thaliana clone 32615 mRNA, complete sequence.
GenBankBT0022060.0BT002206.1 Arabidopsis thaliana homeobox-leucine zipper protein ATHB-12 (At3g61890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413333.11e-179PREDICTED: homeobox-leucine zipper protein ATHB-12
SwissprotQ9M2761e-131ATB12_ARATH; Homeobox-leucine zipper protein ATHB-12
TrEMBLR0H5X01e-137R0H5X0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__2686__AT3G61890.11e-131(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.11e-128homeobox 12